PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 291aa    MW: 33250.3 Da    PI: 8.4511
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16500.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l + + ++G g+W++++ + g+ R +k+c++rw +yl
       KHN16500.1 15 KGLWSPEEDNKLRNHIIKHGHGCWSSVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding50.35.3e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E + +  ++++lG++ W+ Ia++++ gRt++++k++w++yl
       KHN16500.1  68 RGVFSKHEKDTIMALHHMLGNK-WSQIAQHLP-GRTDNEVKNYWHSYL 113
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-22965IPR009057Homeodomain-like
PROSITE profilePS5129416.9941062IPR017930Myb domain
SuperFamilySSF466899.18E-2813109IPR009057Homeodomain-like
SMARTSM007171.8E-111464IPR001005SANT/Myb domain
PfamPF002492.2E-131562IPR001005SANT/Myb domain
CDDcd001674.64E-101862No hitNo description
PROSITE profilePS5129423.92863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2466118IPR009057Homeodomain-like
SMARTSM007173.3E-1467115IPR001005SANT/Myb domain
PfamPF002492.6E-1468113IPR001005SANT/Myb domain
CDDcd001674.10E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MESKPLEKAK PKYRKGLWSP EEDNKLRNHI IKHGHGCWSS VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGV FSKHEKDTIM ALHHMLGNKW SQIAQHLPGR TDNEVKNYWH SYLKKKVIKA  120
KEMESDKQIQ HAGSSSDTVE NALSPQKLAT QDSSYGLLEN LDKSIAQNDN FFSKSYNFSK  180
EAYQSSLPLP KLLFSEWLSV DQVNGGISVN SDDSLVLGNE FDQNSTFQEA IMHMLEENFG  240
EEYHNRLIHS STTEVYNSQI KSTNQMDGSD FMNCIPGNEL RSNFSLTNHG M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-231111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587316.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K44e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0B2Q5D60.0A0A0B2Q5D6_GLYSO; Transcription factor LAF1
TrEMBLK7LDT30.0K7LDT3_SOYBN; Uncharacterized protein
STRINGGLYMA09G25655.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-62myb domain protein 18
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]